PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016467288.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 488aa    MW: 55506.1 Da    PI: 10.7021
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016467288.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.85e-081248138
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38
                     +++W t+E+++l  av+++G+++W+ +a+++   Rt +
   XP_016467288.1 12 KMNWGTWEELILGGAVRRHGTRDWNVVASELR-ARTVY 48
                     689****************************9.99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-41146IPR009057Homeodomain-like
PfamPF002492.2E-61246IPR001005SANT/Myb domain
CDDcd001670.005031458No hitNo description
SuperFamilySSF473701.57E-18253359IPR001487Bromodomain
SMARTSM002971.1E-16255359IPR001487Bromodomain
CDDcd043693.93E-15258354No hitNo description
Gene3DG3DSA:1.20.920.105.6E-17258383IPR001487Bromodomain
PfamPF004393.3E-11264343IPR001487Bromodomain
PROSITE profilePS5001410.829270340IPR001487Bromodomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MEGETMGVGP RKMNWGTWEE LILGGAVRRH GTRDWNVVAS ELRARTVYPY CFTPEACRTS  60
AWFEELRKRR VEELKRELER SESSIGFLES KIESLKAERK QSGQIDYGLG RTESPAPPTK  120
SEDIESFVKD EAKDGLSAGS FTLDIRTNQS PESQVPTIPS TDVKLERSES CERDKVPSTS  180
KVTEASNGNG GAVRKRRGKR RRKDTVWDAK EGSIEESDNV CSTSLASTSH CKEALTSCEQ  240
SIRHSAVSDH RGGLSRFRND DLMRIFTSIT QHEAAMVFRH RLDSQKRARY KKMIRRHMDI  300
ETVKSRLASW SIKTPGELFR DFLLLANNAM VFYSKRTREY KAAMALRDIV TRAYRQHYRG  360
SYYKATSCLL LLPTIGNPPG KPRSVRPRPS KDKLQAKYGN NVKDNIAGKL GRQNHRPGDA  420
DSKVPLQSFL SAKKGFKRPG KIKRGPILES VKPQTKLQAK ESTQHNIKVK EDHRIKPVTK  480
ERKRARQK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195203RRGKRRRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778976.10.0PREDICTED: uncharacterized protein LOC104228236 isoform X2
RefseqXP_016467288.10.0PREDICTED: uncharacterized protein LOC107789922 isoform X2
TrEMBLK4B9A50.0K4B9A5_SOLLC; Uncharacterized protein
STRINGSolyc02g078810.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42150.12e-20DNA-binding bromodomain-containing protein